"context" : "", "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); { "event" : "unapproveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeThreadUserEmailSubscription", "truncateBodyRetainsHtml" : "false", { }, { } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } }, "parameters" : { return false; ] "action" : "rerender" ] "context" : "", { } "action" : "rerender" ], "actions" : [ "message" : "1601142", "componentId" : "forums.widget.message-view", ] ] { "displaySubject" : "true", }, { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_7","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1600211}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1600232}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1600232}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1600242}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1601142}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1721916}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1757057}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1757151}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1757168}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1757189}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1757369}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":852920}}]); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" Giga ist, wo Du bist. ', 'ajax'); "event" : "MessagesWidgetEditAction", Diese wird für die Konfiguration des Routers benötigt. "componentId" : "forums.widget.message-view", })(LITHIUM.jQuery); ] "eventActions" : [ "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName,message", "disableLinks" : "false", { "displaySubject" : "true", "action" : "rerender" count = 0; "event" : "MessagesWidgetEditAnswerForm", lithstudio: [], "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { } { "action" : "rerender" { { } "revokeMode" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.Loader.runJsAttached(); "event" : "QuickReply", "event" : "AcceptSolutionAction", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:entity", "disallowZeroCount" : "false", "context" : "lia-deleted-state", ] ] { }, ] }, ] $(this).next().toggle(); ] "action" : "rerender" } }, "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { { "truncateBody" : "true", "actions" : [ Bist du sicher, dass du fortfahren möchtest? } }, "actions" : [ "context" : "", { { $('div[class*="-menu-btn"]').removeClass('active'); { "event" : "ProductAnswerComment", "actions" : [ element.removeClass('active'); }, '; ] ] "action" : "rerender" "event" : "unapproveMessage", return false; }, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "actions" : [ "action" : "rerender" }, "actions" : [ "useTruncatedSubject" : "true", ] } } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "addThreadUserEmailSubscription", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { ] $(document).keydown(function(e) { }); ] "actions" : [ "initiatorBinding" : true, ] "actions" : [ "action" : "pulsate" ] "showCountOnly" : "false", "action" : "pulsate" { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "event" : "ProductAnswerComment", }, }, "event" : "removeMessageUserEmailSubscription", { }, }, "actions" : [ ] "actions" : [ { "useCountToKudo" : "false", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { { } "context" : "", This router is not the typical pocket size MiFi router that Vodafone sells, but a … } ] "initiatorDataMatcher" : "data-lia-message-uid" "disableLinks" : "false", count = 0; "selector" : "#kudosButtonV2_3", } "event" : "MessagesWidgetCommentForm", } "event" : "removeMessageUserEmailSubscription", ] "useSubjectIcons" : "true", ] "context" : "envParam:quiltName", ] { "event" : "MessagesWidgetAnswerForm", "context" : "", }, "selector" : "#messageview_3", ] "displayStyle" : "horizontal", "actions" : [ "message" : "1600232", "disableKudosForAnonUser" : "false", } "messageViewOptions" : "1111110111111111111110111110100101001101" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Execute whatever should happen when entering the right sequence "actions" : [ ] "context" : "envParam:quiltName,expandedQuiltName", "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48524","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kT6j0gc118Wli-KUdS4IELjtpQLWl9-v9Y4Im9QS7xs. { o.innerHTML = ""; { } "context" : "", "quiltName" : "ForumMessage", "event" : "unapproveMessage", "action" : "rerender" ] ] "kudosable" : "true", "action" : "pulsate" "useSimpleView" : "false", { "initiatorDataMatcher" : "data-lia-message-uid" { }, "parameters" : { element.children('ul').slideDown(); }, { }, "action" : "rerender" ] Öffnen Sie Ihren Webbrowser und geben Sie 192.168..1. in die Adressleiste ein und bestätigen Sie mit [Enter]. "actions" : [ } "event" : "kudoEntity", "event" : "removeThreadUserEmailSubscription", }, ] { }, "actions" : [ "selector" : "#kudosButtonV2_9", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", { ] { { "actions" : [ "context" : "envParam:selectedMessage", { "useSubjectIcons" : "true", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "context" : "envParam:quiltName", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "event" : "ProductMessageEdit", "event" : "MessagesWidgetEditCommentForm", "event" : "approveMessage", }, "context" : "envParam:quiltName,message", ] logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { "actions" : [ }, "selector" : "#kudosButtonV2_9", ] } { }, ] ] }, { { } { "action" : "rerender" { "action" : "rerender" { }; "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:selectedMessage", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "envParam:feedbackData", })(LITHIUM.jQuery); "actions" : [ ] "action" : "rerender" } }, "event" : "MessagesWidgetEditCommentForm", > 0) ) { }, "useCountToKudo" : "false", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'UA6oGZxqixXP8ajGUEjoySKBbAl-SYkg4LQ7phnQ3bU. "; "disableLabelLinks" : "false", }, "action" : "rerender" { "context" : "", }, } "action" : "rerender" ] ] "action" : "rerender" } return; }, } ] "event" : "AcceptSolutionAction", setWarning(pagerId); "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" count = 0; "action" : "rerender" }, } LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "expandMessage", Ein Mirglied der Community hat danach auch geschrieben das es funktioniert hat. "kudosable" : "true", "event" : "MessagesWidgetAnswerForm", "context" : "", "actions" : [ "context" : "", } "event" : "MessagesWidgetCommentForm", $(document).keydown(function(e) { } ], { "event" : "MessagesWidgetEditCommentForm", }, ] ] } "action" : "rerender" { "context" : "", "useTruncatedSubject" : "true", "actions" : [ { "; } "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "expandMessage", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, { "action" : "rerender" { "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "message" : "1721916", "truncateBody" : "true", { "action" : "rerender" "actions" : [ "context" : "", } "parameters" : { ] }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); "action" : "rerender" "revokeMode" : "true", { } "action" : "rerender" ] "componentId" : "kudos.widget.button", "event" : "editProductMessage", ] "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Bist du sicher, dass du fortfahren möchtest? { "context" : "envParam:quiltName,message", "actions" : [ "context" : "", "}); "disableLabelLinks" : "false", "actions" : [ "event" : "removeThreadUserEmailSubscription", LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "event" : "expandMessage", { }, "actions" : [ "action" : "rerender" function doChecks(pagerId, val) { watching = false; "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", ] "context" : "", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "initiatorBinding" : true, { ] { "context" : "", Reddit gives you the best of the internet in one place. { "truncateBody" : "true", { }, "actions" : [ } ], "context" : "", { } "disallowZeroCount" : "false", "event" : "expandMessage", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/27182F110B8560C21A3CB35916861AA4/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" var keycodes = { // --> "event" : "MessagesWidgetMessageEdit", ] watching = true; "actions" : [ "context" : "", $(document).ready(function(){ }, "action" : "pulsate" }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1757168 .lia-rating-control-passive', '#form_7'); "action" : "addClassName" ] "useSimpleView" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); }, "actions" : [ }, "action" : "rerender" "action" : "rerender" ] Einfach das Stromkabel der Shellfire Box in eine Steckdose einstecken. }, "event" : "ProductAnswer", { }, }, } "event" : "markAsSpamWithoutRedirect", "event" : "ProductAnswer", "context" : "", "action" : "rerender" "action" : "rerender" { }, "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); }); "context" : "", "actions" : [ "event" : "approveMessage", "revokeMode" : "true", "includeRepliesModerationState" : "false", }); } "event" : "expandMessage", "includeRepliesModerationState" : "false", } } "event" : "expandMessage", count = 0; "selector" : "#messageview_4", }, "event" : "unapproveMessage", { "context" : "envParam:feedbackData", "event" : "removeMessageUserEmailSubscription", } }, }); { } })(LITHIUM.jQuery); ] "event" : "MessagesWidgetAnswerForm", }, "context" : "", "accessibility" : false, "context" : "", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "action" : "rerender" }, { }, { "action" : "rerender" { { { { }); } ] function clearWarning(pagerId) { { } } } "eventActions" : [ ] "actions" : [ "actions" : [ // Oops, not the right sequence, lets restart from the top. { }, }, }, "event" : "MessagesWidgetEditAction", { { function setWarning(pagerId) { }, "actions" : [ LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "event" : "kudoEntity", { } }, "eventActions" : [ "action" : "rerender" }, { }, LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "actions" : [ ] { { "parameters" : { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "disableLinks" : "false", "actions" : [ ] "action" : "pulsate" "context" : "", ] "actions" : [ } "event" : "approveMessage", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48524","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gSnYqSW3QDqv9FzM8a3-SXKcL_BEEcvWLd3c4xL-mS4. "actions" : [ "context" : "envParam:selectedMessage", "kudosable" : "true", LITHIUM.Dialog.options['1685736081'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'qWcsPx-zba30Kl4U8ide8PRCgVYhbo6Sv3OOibA1XQ8. $(document).ready(function(){ { ] }, "event" : "markAsSpamWithoutRedirect", "actions" : [ "action" : "rerender" { { }, "truncateBodyRetainsHtml" : "false", if ( Number(val) < 1 ) { "actions" : [ "action" : "rerender" "actions" : [ "event" : "addThreadUserEmailSubscription", "actions" : [ disableInput(pagerId); "context" : "envParam:quiltName,expandedQuiltName", { "action" : "rerender" '; LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_77a98008018f2f_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48524&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { } } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "quiltName" : "ForumMessage", ] ] "context" : "", "action" : "rerender" "event" : "AcceptSolutionAction", "action" : "rerender" }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, "actions" : [ } "action" : "rerender" ] "context" : "", }, { "context" : "envParam:feedbackData", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { "useSimpleView" : "false", { } { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableKudosForAnonUser" : "false", "kudosLinksDisabled" : "false", "event" : "RevokeSolutionAction", "event" : "unapproveMessage", } "initiatorDataMatcher" : "data-lia-message-uid" }, "context" : "", { "includeRepliesModerationState" : "false", "action" : "rerender" { LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); }, "context" : "", "message" : "1721916", "context" : "", "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '5AO1wPLgSoevLtW6yr98kcQDvar03wG0ZHcIbOG3Bzg. "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "addThreadUserEmailSubscription", ] "disableKudosForAnonUser" : "false", "displayStyle" : "horizontal", "useCountToKudo" : "false", { { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"}); $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "forceSearchRequestParameterForBlurbBuilder" : "false", ] { { ] { } } "event" : "ProductMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/48524","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tsB8V_-sU_RbOkC29Bg6304bJbLKnSBuRvdc4KcutOs. } LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, "initiatorBinding" : true,